Sequence:
APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENCDKPRR
Activity:
Determined by its ability to stimulate the proliferation of human umbilical vein endothelial cells (HUVEC). The expected ED50 for this effect is 1.0-5.0 ng/ml.
Endotoxin:
Less than 0.01 ng/µg of protein (Less than 0.1 EU/µg).
Purity:
Greater than 98% by SDS-PAGE and HPLC
Reconstitution:
If lyophilized, can be stored for 1 month at room temperature, 6 months at 4°C, or through the expiration date at -20°C to -80°C. Once reconstituted per the supplied instructions, can be stored for 3 months at -20°C to -80°C, or for 1 week at 2°C to 8°C. Avoid freeze-thaw cycles.
Storage:
If lyophilized, can be stored for 1 month at room temperature, 6 months at 4°C, or through the expiration date at -20°C to -80°C. Once reconstituted per the supplied instructions, can be stored for 3 months at -20°C to -80°C, or for 1 week at 2°C to 8°C. Avoid freeze-thaw cycles.
